PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10014211m
Common NameCARUB_v10014211mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 319aa    MW: 35449.6 Da    PI: 8.8716
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10014211mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1645.5e-51141391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF Ptdeel+veyL++k++g +++l + i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + s
  Carubv10014211m  14 LPPGFRFYPTDEELMVEYLCRKAAGYDFSL-QLIAEIDLYKFDPWVLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVISS 106
                      79***************************9.89***************8777899***********************************9999 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Carubv10014211m 107 -EGRRVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                      .9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-6610162IPR003441NAC domain
PROSITE profilePS5100559.65714162IPR003441NAC domain
PfamPF023652.9E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGLQELDPLA QLSLPPGFRF YPTDEELMVE YLCRKAAGYD FSLQLIAEID LYKFDPWVLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVISSEGRR VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLF EPSRRNGSAK LDDWVLCRIY KKQTSAQKQV YNNQILSGGR  180
EYSNNGSSTS SSSHQYDDVL ESLHEIDNRS LGFAAGSSNA LPHHSHRPVL TSQKTGFHGL  240
AREPSFDWAN LVGQNSVPEL GLGHNVPSLR YGDGGAQQQT EGIPRFNNSD VLAHQGFSVD  300
PVNGIGFSGQ QNSGFGFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-11811684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-11811684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-11811684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-11811684171NO APICAL MERISTEM PROTEIN
3swm_A1e-11711687174NAC domain-containing protein 19
3swm_B1e-11711687174NAC domain-containing protein 19
3swm_C1e-11711687174NAC domain-containing protein 19
3swm_D1e-11711687174NAC domain-containing protein 19
3swp_A1e-11711687174NAC domain-containing protein 19
3swp_B1e-11711687174NAC domain-containing protein 19
3swp_C1e-11711687174NAC domain-containing protein 19
3swp_D1e-11711687174NAC domain-containing protein 19
4dul_A1e-11811684171NAC domain-containing protein 19
4dul_B1e-11811684171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00360DAPTransfer from AT3G15500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0490700.0AB049070.1 Arabidopsis thaliana AtNAC3 mRNA, complete cds.
GenBankBT0256590.0BT025659.1 Arabidopsis thaliana At3g15500 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298161.10.0hypothetical protein CARUB_v10014211mg
SwissprotQ9LDY80.0NAC55_ARATH; NAC domain-containing protein 55
TrEMBLR0HMX60.0R0HMX6_9BRAS; Uncharacterized protein
STRINGAT3G15500.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.10.0NAC domain containing protein 3